Функции белков в клетке схема


Функции белков в клетке - схема, таблица — Схемо.РФ

  • Войти
  • Регистрация
  • Схемы
    • Биология
    • География
    • История
    • Математика и алгебра
    • Медицина
    • Обществознание
    • Педагогика
    • Политология
    • Право
    • Психология
    • Русский язык
    • Социология
    • Физика
    • Философия
    • Химия
    • Экономика
    • Прочее
  • Книги
    • Биология
    • География
    • История
    • Математика и алгебра
    • Медицина
    • Обществознание
    • Педагогика
    • Политология
    • Право
    • Психология
    • Русский язык
    • Социология
    • Физика
    • Философия
    • Химия
    • Экономика
    • Прочее
  • Комментарии
  • Люди

xn--e1aogju.xn--p1ai

Строение и функции белков - конспект

  
Вернуться к теме "Строение и функции белков"

Белки – полимеры, мономерами которых являются аминокислоты.

Среди органических веществ белки занимают первое место по количеству и по значению. В организме человека встречаются 5 млн разнообразных белковых молекул, отличающихся не только друг от друга, но и от белков других организмов. Несмотря на такое разнообразие и сложность строения они построены всего из 20 различных аминокислот.

Строение аминокислоты:

 

В левой части молекулы расположены группа h3N–, которая обладает свойствами основания; справа - группа –COOH - кислотная, характерная для всех органических кислот. Следовательно, аминокислоты – амфотерные соединения, совмещающие свойства и кислоты и основания. Этим обусловлена их способность взаимодействовать друг с другом. Соединяясь, молекулы аминокислот образуют связи между углеродом кислотной и азотом основной групп. Такие связи называются ковалентными, а в данном случае – пептидными связями:

Соединение двух аминокислот в одну молекулу называется дипептидом, трех аминокислот – трипептидом и т. д., а соединение, состоящее из 20 и более аминокислотных остатков, – полипептидом.

Последовательность аминокислот в полипептидной цепи принято называть первичной структурой белка.

Однако молекула белка в виде цепи аминокислотных остатков, последовательно соединенных между собой пептидными связями, еще не способна выполнять специфические функции. Для этого необходима более высокая структурная организация. Путем образования водородных связей между остатками карбоксильных и аминогрупп разных аминокислот белковая молекула принимает вид спирали (α-структура) или складчатого слоя – «гармошки» (β-структура). Это вторичная структура белка. Но и ее часто недостаточно для приобретения характерной биологической активности.

Часто только молекула, обладающая третичной структурой, может выполнять роль катализатора или любую другую. Третичная структура образуется благодаря взаимодействию радикалов, в частности радикалов аминокислоты цистеина, которые содержат серу. Атомы серы двух аминокислот, находящихся на некотором расстоянии друг от друга в полипептидной цепи, соединяются, образуя так называемые дисульфидные, или S–S, связи. Благодаря этим взаимодействиям, а также другим, менее сильным связям, белковая спираль сворачивается и приобретает форму шарика, или глобулы. Способ укладки полипептидных спиралей в глобуле называют третичной структурой белка. Многие белки, обладающие третичной структурой, могут выполнять свою биологическую роль в клетке. Однако для осуществления некоторых функций организма требуется участие белков с еще более высоким уровнем организации.

Такую организацию называют четвертичной структурой. Присутствует не у всех белков. Она представляет собой функциональное объединение нескольких (двух, трех и более) молекул белка, обладающих третичной структурной организацией. Пример такого сложного белка – гемоглобин. Его молекула состоит из четырех связанных между собой молекул. Другим примером может служить гормон поджелудочной железы – инсулин, включающий два компонента. В состав четвертичной структуры некоторых белков включаются помимо белковых субъединиц и разнообразные небелковые компоненты. Тот же гемоглобин содержит сложное гетероциклическое соединение, в состав которого входит железо.

Строение белковой молекулы: А – первичная; Б – вторичная; В – третичная; Г – четвертичная структура

Строение молекулы гемоглобина

Гемоглобин – белок четвертичной структуры. В молекуле гемоглобина белковый компонент представлен белком глобином, небелковый компонент – гем. Глобин состоит из 4 субъединиц. Внутри каждой субъединицы имеется гидрофобный «карман», в котором располагается гем. Содержащийся в геме атом железа связывает кислород.

Свойства белка

Белки, как и другие неорганические и органические соединения, обладают рядом физико-химических свойств:

  1. Белки – преимущественно водорастворимые молекулы и, следовательно, могут проявлять свою функциональную активность только в водных растворах.
  2. Белковые молекулы несут большой поверхностный заряд. Это определяет целый ряд электрохимических эффектов, например изменение проницаемости мембран каталитической активности и других функций.
  3. Белки термолабильны, то есть проявляют свою активность в узких температурных рамках.

Денатурация и ренатурация белков

Денатурация  – это утрата белковой молекулой своей структурной организации: четвертичной, третичной, вторичной, а при более жестких условиях – и первичной структуры. В результате денатурации белок теряет способность выполнять свою функцию. Причинами денатурации могут быть высокая температура, ультрафиолетовое излучение, действие сильных кислот и щелочей, тяжелых металлов и органических растворителей. Если изменение условий среды не приводит к разрушению первичной структуры молекулы, то при восстановлении нормальных условий среды полностью воссоздается структура белка и его функциональная активность. Такой процесс носит название ренатурации.

Функции белков

1. Каталитическая (ферментативная) функция:

Многие белки являются ферментами. Ферменты — это биологические катализаторы, т. е. вещества, ускоряющие протекание химических реакций в живых организмах. Ферменты участвуют в процессах синтеза и расщепления различных веществ. Они обеспечивают фиксацию углерода в процессе фотосинтеза, расщепление питательных веществ в пищеварительном тракте и т. д. 

 

2. Транспортная функция

Многие белки способны присоединять и переносить различные вещества. Гемоглобин связывает и переносит кислород и углекислый газ. Альбумины крови транспортируют жирные кислоты, глобулины — ионы металлов и гормоны. Многие белки, входящие в состав цитоплазматической мембраны, участвуют в транспорте веществ в клетку и из нее.

3. Защитная функция

Белки предохраняют организм от вторжения чужеродных организмов и от повреждений. Так, в ответ на проникновение чужеродных объектов (антигенов) определенные лейкоциты вырабатывают специфические белки — иммуноглобулины (антитела), участвующие в иммунном ответе организма. Белок плазмы крови фибриноген, участвуя в свертывании крови и тем самым уменьшая кровопотери.

4. Двигательная (сократительная) функция

Сократительные белки обеспечивают способность клеток, тканей, органов и целых организмов изменять форму, двигаться. Так, актин и миозин обеспечивают работу мышц и немышечные внутриклеточные сокращения.

5. Структурная (строительная, пластическая) функция

Белки входят в состав всех клеток и тканей живых организмов. Белки являются обязательным компонентом всех клеточных мембран и органоидов клетки. Из белков построены элементы цитоскелета, сократительные элементы мышечных волокон. Преимущественно из белков состоят хрящи и сухожилия. В их состав входит белок коллаген. Важнейшим структурным компонентом перьев, волос, ногтей, когтей, рогов, копыт у животных является белок кератин. В состав связок, стенок артерий и лёгких входит структурный белок эластин.

6. Сигнальная (рецепторная) функция

Некоторые белки клеточных мембран способны изменять свою структуру в ответ на действие внешних факторов. С помощью этих белков происходит прием сигналов из внешней среды и передача информации в клетку.

7. Регуляторная функция

Некоторые белки являются гормонами. Они влияют на различные физиологические процессы. Например, инсулин и глюкагон регулируют содержание глюкозы в крови, а соматотропин (гормон роста) — процессы роста и физического развития.

8. Запасающая (питательная) функция

В семенах растений запасаются резервные белки, которые используются при прорастании зародышем.

9. Энергетическая функция

При полном окислении 1 г белка выделяется 17,6 кДж энергии. Однако белки расходуются на энергетические нужды лишь в крайних случаях, когда исчерпаны запасы углеводов и жиров.

biologyonline.ru

Строение и функции белков

Строение белков

Определение 1

Белки – сложные органические соединения (биополимеры), в состав молекул которых входят углерод, водород, кислород и азот (иногда серы). Их мономеры - аминокислоты.

Белки играют первостепенное значение в жизни всех организмов. Они характеризуются неисчерпаемым разнообразием, которое одновременно очень специфично.

Замечание 1

Белки и нуклеиновые кислоты являются материальной основой всего богатства организмов окружающей среды. Их доля составляет 50 – 80% сухой массы клетки.

Молекулы белков похожи на длинные цепи, состоящие из 50 – 1500 остатков аминокислот, соединённых крепкой ковалентной азотно-углеродной (пептидной) связью. В результате образуется первичная структура белка - полипептидная цепь.

Замечание 2

Молекула белка - это полипептид, молекулярная масса которого составляет от 5 тыс. до 150 тыс. Бывает и больше.

Простые белки состоят лишь из аминокислот, а сложные белки, кроме аминокислот, могут содержать нуклеиновые кислоты (нуклеопротеиды), липиды (липопротеиды), углеводы (гликопротеиды), окрашенные химические соединения (хромопротеиды) и т.п.

Все свойства клетки (химические, морфологические, функциональные) зависят от специфических белков, содержащихся в ней.

Замечание 3

Именно набор аминокислот, их количество и последовательность расположения в полипептидной цепи и определяет специфичность белка.

Замена лишь одной аминокислоты в составе белковой молекулы или изменение последовательности расположения аминокислот может привести к изменению функций белка. Этим и объясняется большое разнообразие в строении белковой молекулы первичной структуры. Потому не удивительно, что живой организм, чтобы иметь возможность выполнять свои функции, использует особенный виды белков и его возможности в этом отношении неограниченные.

Пространственное расположение полипептидных цепей также определяет свойства белков. В живой клетке полипептидные цепи скрученные или согнутые, имеют вторичную или третичную структуру.

Вторичная структура представлена спирально закрученной белковой цепочкой. Витки спирали удерживаются благодаря водородным связям, образующимся между расположенными на соседних витках СО – и NH – группами.

В результате дальнейшего закручивания спирали возникает специфическая конфигурация каждого белка - третичная структура. Образуется она благодаря связям между белковыми радикалами аминокислотных остатков:

  • ковалентным дисульфидным (S – S-связям) между остатками цистеина,
  • водородным,
  • ионными.
  • гидрофобным взаимодействиям.

В количественном соотношении наиболее важными являются гидрофобные взаимодействия, вызванные тем, что неполярные боковые цепи аминокислот стремятся объединиться друг с другом, не смешиваясь с водной средой. Белок при этом свёртывается так, чтобы его гидрофобные боковые цепи были спрятаны внутри молекулы, то есть защищены от контакта с водой, а наружу, наоборот, выставлены боковые гидрофильные цепи.

Для каждого белка специфичны количество молекуламинокислот с гидрофобными радикалами и количество молекул цистеина и характер их взаимного расположения в полипептидной цепи.

Взаимное расположение групп атомов, обходимое для проявления активности белка как катализатора, его гормональных функций и др. обеспечивается сохранением определённой формы молекулы. Потому стойкость макромолекул – не случайное свойство, а один из важнейших способовстабилизации организма.

Биологическая активность белка может проявлятся лишь когда он имеет третичную структуру, потому при замене в полипептидной цепи даже одной аминокислоты могут возникнуть изменения в конфигурации белка, а его биологическая активность снизится или же исчезнет совсем.

Иногда две, три, и больше белковых молекул с третичной структурой могут объединиться в единый комплекс. Подобные образования являются четвертичной структурой белка.

Пример 1

Примером такого сложного белка является гемоглобин, который состоит из четырёх субединиц и небелковой части – гема. Он способен выполнять свои функции только в такой форме.

В четвертичной структуре белковые субединицы не связаны химически, однако вся структура достаточно крепкая благодаря действию слабых межмолекулярных сил.

Под влиянием разнообразных физических и химических факторов (обработка щелочами, кислотами, спиртом, ацетоном, влияние высоких температур и давления и пр.) третичная и четвертичная структуры белка изменяются, потому что разрываются водородные и ионные связи.

Определение 2

Денатурация – нарушение естественной (нативной) структуры белка.

При денатурации уменьшается растворимость белков, изменяется форма и размеры молекул, теряется ферментативная активность и т.п. Процесс денатурации оборотный, то есть возвращение нормальных условий сопровождается непроизвольным оновлением естественной (природной) структуры белка. Этот процесс называют ренатурацией.

Замечание 4

Все особенности строения и функционирования белковой макромолекулы зависят от его первичной структуры.

Функции белков в клетке

  • Строительная (пластическая) функция белковых молекул является одной из важнейших.Они являются составным компонентом клеточных мембран и органел. Стенки кровеносных сосудов, сухожилия, хрящи высших животных также состоят в основном из белка.
  • Двигательная функция обеспечивается особенными сократительными белками, благодаря которым осуществляются движения жгутиков и ресничек, перемещение хромосом во время деления клеток, сокращение мускулатуры, движения органов растений и т.п., пространственные изменения положения различных структур организма.
  • Транспортная функция белков обеспечивается их способностью связывать и переносить с течением крови химические соединения.

Пример 2

Белок крови гемоглобин переносит кислород из лёгких в клетки других органов и тканей (аналогичную функцию в мышцах выполняет миоглобин).

Белки сыворотки крови переносят липиды и жирные кислоты, различные биологически активные вещества.

Молекулы белков, входящих в состав плазматической мембраны, берут участие в транспорте веществ как в клетку, так и из неё.

Белки выполняют и защитную функцию. Как ответ на проникновение внутрь чужеродных веществ (антигенов – белков или высокомолекулярных полисахаридов бактерий, вирусов) в клетке вырабатываются особенные белки – иммуноглобулины (антитела), которые нейтрализуют чужеродные вещества и осуществляют иммунологичную защиту организма.

Благодаря функционированию иммунной системы организма обеспечивается распознавание антигенов антигенным детерминантам (характерным участкам их молекул). Благодаря этому специфически связываются и обеззараживаются чужеродные вещества за.

Замечание 5

Внешнюю защитную функцию могут выполнять также и белки, токсические для других организмов ( белок яда змей).

Белкам свойственна также сигнальная функция. В поверхность клеточной мембранны встроены молекулы белков, которые в ответ на действия факторов внешней среды способны к изменению свей третичной структуры. Так происходит восприятие сигналов из внешней среды и передача команд в клетку.

Регуляторная функция свойственна белкам-гормонам, которые влияют на обмен веществ. Гормоны поддерживают постоянную концентрацию веществ в крови, учавствуют в росте размножении и других жизненно важных процессах.

Пример 3

Одним из наиболее известных гормонов является инсулин, понижающий содержание сахара в крови. В случае стойкой недостаточности инсулина содержание сахара в крови увеличивается и развивается сахарны диабет. Главными регуляторами биохимических процессов в организме могут быть и многочисленные белки-ферменты (каталитическая функция).

Белки являются и энергетическим материалом. При расщеплении 1 г белка до конечных продуктов выделяется 17,6 кДж энергии, необходимой для большинства жизненно важных процессов в клетке.

Ферменти, их роль в клетке

Определение 3

Ферменты (энзимы) – это специфические белки, присутствующие во всех организмах и выполняющие функцию биологических катализаторов.

Химические реакции в живой клетке происходят при умеренной температуре нормальном давлении и в нейтральной среде. При таких условиях течение реакций синтеза или распада веществ в клетке был быочень медленным, если бы не действие ферментов. Ферменты ускоряют реакции за счёт снижения энергии активации не измененяя их общего результата, то есть при их наличии для придания молекулам, вступающим в реакцию, реакционной способности, необходимо значительно меньше энергии

Все процессы в живом организме прямо или косвенно происходят с участием ферментов.

Под действием ферментов составляющие компоненты пищи (белки, липиды, углеводы и др.) расщепляются до простейших соединений, а из них позже синтезируются новые, свойственные данному виду макромолекулы. Потому нарушение образования и активности ферментов часто становятся причиной тяжёлых заболеваний.

Ферментативный катализ подчиняется тем же законам, что и неферментативный катализ в химической промышленности, однако в отличие от последнего характеризируется чрезвычайно высокой степенью специфичности (фермент катализирует только одну реакцию или действует лишь на один тип связи). Этим обеспечивается тонкое регулирование всех жизненно важных процессов (дыхание, пищеварение, фотосинтез и т. п.), происходящих в клетке и организме.

Пример 4

Фермент уреаза катализирует расщепление только одного вещества – мочевины, но не действует каталитически на структурно родственные соединения.

Для понятия механизма действия ферментов, которые имеют высокую специфичность, чрезвычайно важна теория активного центра. Согласно с ней, в молекуле каждого фермента есть один или больше участков, в которых катализ происходит за счёт тесного (во многих местах) контакта между молекулами фермента и субстрата (специфического вещества), а функциональная группа (пример – ОН – группа аминокислоты серина), или же отдельная аминокислота, выступает активным центром.

Обычно для действия катализатора необходимо, чтобы объединились несколько аминокислотных остатков, расположенных в определённой последовательности (в среднем 3 – 12).

Активный центр также может формироваться благодаря связи ферментов с ионами металов, витаминами и другими соединениями небелковой природы – так называемыми коферментами, или кофакторами.

Химическое строение и форма активного центра такова, что с ним способны связывать лишь определённые субстраты благодаря их идеальному соответствию (взаимодополняемости, или комплементарности) друг другу.

Остальные аминокислотные остатки обеспечивают большой молекуле ферментп соответствующую глобулярную форму, необходимую для эффективной работы самого центра.

Кроме того, вокруг большой молекулы фермента возникает сильное электрическое поле. В таком поле становится возможной ориентация молекул субстрата и приобретение ими ассиметрической формы. В результате ослабевают химические связи и начальная затрата энергии на реакцию, которая катализируется, будет меньше, а значит, значительно увеличится её скорость.

Пример 5

Одна молекула фермента каталазы способна за 1 мин расщепить более 5 млн. молекул перекиси водорода, которая возникает во время окисления в организме различных соединений.

Активный центр некоторых ферментов в присутствии субстрата может изменять конфигурацию: для обеспечения наибольшей каталитической активности такой фермент специально ориентирует свои функциональные группы. Молекулы субстрата, присоединяясь к ферменту, также в определённых пределах изменяют свою конфигурацию для увеличения реакционной способностит функциональных групп центра. На заключительном этапе химической реакции комплекс фермента и субстрата распадается, образуются конечные продукты и свободный фермент. Активный центр при этом освобождается и способен снова принимать новые молекулы субстрата.

Скорость реакций с участием ферментов зависит от многих факторов: от концентрации фермента, от природы субстрата, от давления, температуры, кислотности среды, от наличия ингибиторов.

При температурах, близких к 0˚С, до минимума замедляется скорость биохимических реакций. Это свойство широко используют в различных отраслях, особенно в медицине и сельском хозяйстве.

Пример 6

Для консервации органы человека (почки, серце, селезёнка, печень) перед пересадкой больному подвергают охлаждению, чтобы понизить интенсивность биохимических реакций и тем самым продлить время жизни этих органов. При быстром замораживании пищевых продуктов предотвращается размножение микроорганизмов, а так же инактивируются их ферменты, потому они уже не способны вызывать разложение пищевых продуктов.

spravochnick.ru

Функции белков в клетке — Студопедия

Название функции Пояснения
1. Каталитическая Большинство белков – ферменты-энзимы (катализаторы всех реакций, протекающих в клетке)  
2. Строительная или структурная Основа клеточных органоидов, волос, сосудов  
3. Двигательная или сократительная Жгутики простейших - сократительные белки; белки мышц, ресничек, перемещения хромосом при делении - актин и миозин  
4. Транспортная Гемоглобин - транспорт кислорода и углекисло­го газа Белки цитоплазматической мембраны транспортируют вещества в клетку.
5. Защитная Антитела – имунноглобулины (обеспечение иммунитета к заболева­ниям). Фибриноген и фибрин участвуют в свертываемости крови.  
6. Энергетическая Некоторые белки служат источником энергии При полном окислении (гидролизе) 1г белка выделяется 17,6 кДж энергии.  
7. Регуляторная Белки-гормоны влияют на обмен веществ (инсулин)  
8. Сигнальная или рецепторная Белки-рецепторы, способные в результате изменения собственной структуры, передавать сигнал в клетку и включать цепи химических реакций. Родопсин – пигмент Находящийся в клетках сетчатки глаза.
9. Токсическая Обнаруживается в яде змей, насекомых, грибах,у микроорганизмов.

Некоторые функции, выполняемые белками.

Класс Выполняемая функция Примеры белков
Ферменты Служат катализаторами определенных химических реакции; у разных организмов обнаружено более 2000 различных ферментов. Амилаза расщепляет крахмал до глюкозы; липаза расщепляет жиры до глицерина и жирных кислот.
Структурные белки Являются структурными компонентами биологических мембран и многих внутриклеточных органелл, главным компонентом опорных структур организма. Коллаген хрящей и сухожилий, эластин соединительной ткани, кератин волос и ногтей.
Сократительные белки Обеспечивают движение клеток, внутриклеточных структур. Актин и миозин мышечного волокна, тубулин микротрубочек.
Транспортные белки Связывают и переносят специфические молекулы и ионы из одного органа в другой. Гемоглобин переносит кислород, сывороточный альбумин – жирные кислоты.
Пищевые белки Питают зародыш на ранних стадиях развития и запасают биологически ценные вещества и ионы. Казеин молока; ферритин, запасающий железо в селезенке.
Защитные белки Предохраняют организм от вторжения других организмов и повреждений. Антитела, вырабатываемые лимфоцитами, блокируют чужеродные антигены; фибриноген и тромбин, предохраняющие организм от кровопотери.
Регуляторные белки Участвуют в регуляции активности клетки и организма. Инсулин регулирует обмен глюкозы; гистоны – генную активность.

Желудочный сок обладает свойством переваривать пищу, что связано с наличием в нем ферментов. Он содержит пепсин - фермент, расщепляющий белок.


ферментов является трипсин, находящийся в соке поджелудочной железы Образование нового белка в организме человека и животных идет беспрерывно, так как в течении всей жизни взамен отмирающих клеток крови, кожи, слизистой оболочки, кишечника и т. д. создаются новые, молодые клетки. Для того чтобы клетки организма синтезировали белок, необходимо, чтобы белки поступали с пищей в пищеварительный канал, где они подвергаются расщеплению на аминокислоты, и уже из всосавшихся аминокислот будет образован белок.

К полноценным белкам относятся преимущественно белки животного происхождения, кроме желатины, относящейся к неполноценным белкам. Неполноценные белки - преимущественно растительного происхождения. Однако некоторые растения (картофель, бобовые и др.) содержат полноценные белки. Из животных белков особенно большую ценность для организма представляют белки мяса, яиц, молока и др.

studopedia.ru

Строение и функции белков

Урок изучения нового материала в 10-м классе. Данный материал учащиеся уже изучали в 9 классе, поэтому некоторые понятия им уже известны. Соответственно с ребятами ведется диалог о строении и функциях белков. С помощью учителя учащиеся узнают о классификации ферментов.

Для того, чтобы активизировать деятельность учащихся на уроке, приводятся интересные факты о белках, которые помогают ребятам и нацеливают их на дальнейшее усвоение нового материала. Так же для этих целей предлагается провести лабораторную работу. На данном уроке основная масса изучаемого материала записывается в виде таблиц, схемы, которые учитель строит в ходе урока вместе и учениками. Качество изучаемого материала проверяется в виде фронтального опроса. Урок рассчитан как на детей-аудиалов, так и визуалов.

Цель урока: дать представление о строении и функции белков.

Задачи: продолжить расширение и углубление знаний важнейших органических веществах клетки на основе изучения строения и функции белков, сформировать знания функциях белков и их важнейшей роли в органическом мире, продолжить формирование умения выявлять связи между строением и функциями веществ.

Основные понятия: белки, протеины, протеиды, пептид, пептидная связь, простые и сложные белки, первичная, вторичная, третичная и четвертичная структуры белков денатурация.

Средства обучения: таблицы по общей биологии, иллюстрирующие строение молекул белков; лабораторное оборудование для проведения лабораторной работы “Расщепление пероксида водорода с помощью ферментов, содержащихся в плетках листа элодеи”.

Ход урока

I. Изучение нового материала.

1. Рассказ учителя (или фрагмент лекции) об особенностях строения молекул белков как биополимеров, состоящих из большого количества разных аминокислот, между которыми происходит полимеризация на основе пептидной связи. Зарисовка и запись на доске и в тетрадях учащихся.

2. Самостоятельное изучение учащимися текста учебника (С.42) о классификации белков.

3. Беседа об уровнях организации белковой молекулы и химической основы каждого из четырех уровней (структур) этой молекулы, о денатурации как утрате белковой молекулы своей природной структуры.

Структура белковой молекулы.

Структура белка Характеристика Тип связи Схема (учащиеся рисуют самостоятельно)
Первичная Линейная структура – последовательность аминокислот в полипептидной цепи, которая определяет все другие структуры молекулы, а также свойства и функции белка. Пептидная.
Вторичная Закручивание полипептидной цепи в спираль или складывание в “гармошку”. Водородные связи.
Третичная Глобулярный белок: упаковка вторичной структуры в глобулу;
фибриллярный белок: несколько вторичных структур, уложенных параллельными слоями, или скручивание нескольких вторичных структур наподобие каната в суперспираль.
Ионные, водородные, дисульфидные, гидрофобные.
Четвертичная Встречается редко. Комплекс из нескольких третичных структур органической природы и неорганическое вещество, например, гемоглобин. Ионные, водородные, гидрофобные.

4. Рассказ учителя о многообразии функций белков с краткой записью в тетрадях сущности функций: структурной, ферментативной, транспортной, защитной, регуляторной, энергетической, сигнальной.

5. Лабораторная работа “Расщепление пероксида водорода с помощью ферментов, содержащихся в клетках листа элодеи”.

Ход работы:

а. Приготовьте микропрепарат листа элодеи и рассмотрите его под микроскопом.
б. Капните на микропрепарат немного пероксида водорода и еще раз рассмотрите, в каком состоянии находятся клетки листа элодеи.
в. Объясните, с чем связано выделение пузырьков из теток листа, что это за газ, на какие вещества может расщепиться пероксид водорода, какие ферменты участвуют в этом процессе?
г. Капните каплю пероксида на предметное стекло и, рассмотрев его под микроскопом, опишите наблюдаемую, картину. Сравните состояние пероксида водорода в листе элодеи и на стекле, сделайте выводы.

По завершении лабораторной работы следует провести беседу о биохимических реакциях, протекающих при участии белковых катализаторов-ферментов как основе жизнедеятельности клеток и организмов.

Химические свойства белков обусловлены их различным аминокислотным составом. Существуют белки хорошо растворимые в воде и совершенно нерастворимые, химически активные и устойчивые к действию различных агентов, способные укорачиваться и растягиваться и т. д.

Под влиянием различных факторов – высокой температуры, действия химических веществ, облучения, механического воздействия – может произойти разрушение структур белковой молекулы. Нарушение природной структуры белка называется денатурацией. Если воздействие перечисленных факторов было недолгим и несильным, то белок может вернуть свою природную структуру – обратимая денатурация (ренатурация), если же воздействие было долгим или сильным, то происходит нарушение не только третичной и вторичной структур, но и первичной – необратимая денатурация (рис. 3).

Функции белков.

Функция Характеристика
1. Строительная (структурная). Входят в состав клеточных мембран и органоидов клетки (липопротеиды и гликопротеиды), участвуют в образовании стенок кровеносных сосудов, хрящей, сухожилий (коллаген) и волос (кератин).
2. Двигательная Обеспечивается сократительными белками (актин и миозин), которые обуславливают движение ресничек и жгутиков, сокращение мышц, перемещение хромосом при делении клетки, движение органов растений.
3. Транспортная. Связывают и переносят с током крови многие химические соединения, например, гемоглобин и миоглобин транспортируют кислород, белки сыворотки крови переносят гормоны, липиды и жирные кислоты, различные биологически активные вещества.
4. Защитная. Выработка антител (иммуноглобулинов) в ответ на проникновение в нее чужеродных веществ (антигенов), которые обеспечивают иммунологическую защиту; участие в процессах свертывания крови (фибриноген и протромбин).
5, Сигнальная (рецепторная). Прием сигналов из внешней среды и передача команд в клетку за счет изменения третичной структуры встроенных в мембрану белков в ответ на действие факторов внешней среды. Например, гликопротеины (встроены в гликокал икс), опсин (составная часть светочувствительных пигментов родопсина и йодопсина), фитохром (светочувствительный белок растений).
6. Регуляторная. Белки-гормоны оказывают влияние на обмен веществ, т. е. обеспечивают гомеостаз, регулируют рост, размножение, развитие и другие жизненно важные процессы. Например, инсулин регулирует уровень глюкозы в крови, тироксин – физическое и психическое развитие и т.д.
7. Каталитическая (ферментативная). Белки-ферменты ускоряют биохимические процессы в клетке.
К. Запасающая Резервные белки животных: альбумин (яйца) запасает воду, ферритин – железо в клетках печени, селезенки; миоглобин – кислород в мышечных волокнах, казеин (молоко) и белки семян – источник питания для зародыша.
9. Пищевая (основной источник аминокислот). Белки пищи – основной источник аминокислот (особенно незаменимых) для животных и человека; казеин (белок молока) – основной источник аминокислот для детенышей млекопитающих.
10. Энергетическая. Являются источником энергии – при окислении 1 г белка выделяется 17,6 кДж энергии, но организм использует белки в качестве источника энергии очень редко, например, при длительном голодании.

Ферменты (энзимы) – это специфические белки, которые присутствуют во всех живых организмах и играют роль биологических катализаторов.

Химические реакции в живой клетке протекают при умеренной температуре, нормальном давлении и нейтральной среде. В таких условиях реакции синтеза или распада веществ протекали бы очень медленно, если бы не подвергались воздействию ферментов. Ферменты ускоряют реакцию без изменения ее общего результата за счет снижения энергии активации. Это означает, что в их присутствии требуется значительно меньше энергии для придания реакционной способности молекулам, которые вступают в реакцию. Ферменты отличаются от химических катализаторов высокой степенью специфичности, т. е. фермент катализирует только одну реакцию или действует только на один тип связи. Скорость ферментативных реакций зависит от многих факторов – природы и концентрации фермента и субстрата, температуры, давления, кислотности среды, наличия ингибиторов и т.д.

Классификация ферментов. 

Группа Катализируемые реакции, примеры
Оксидоредуктазы. Окислительно-восстановительные реакции: перенос атомов водорода (Н) и кислорода (О) или электронов от одного вещества к другому, при этом окисляется первый и восстанавливается второй. Участвуют во всех процессах биологического окисления, например, вдыхании: АН + В А ВН (окисленный) или А + О АО (восстановленный).
Трансферазы. Перенос группы атомов (метильной, ацильной, фосфатной или аминогруппы) от одного вещества к другому. Например, перенос остатков фосфорной кислоты от АТФ на глюкозу или фруктозу под действием фототрансфераз:
АТФ + глюкоза глюкозо-6-фосфат + АДФ.
Гидролазы. Реакции расщепления сложных органических соединений на более простые путем присоединения молекул воды в месте разрыва химической связи (гидролиз). Например, амилаза (гидролизирует крахмал), липаза (расщепляет жиры), трипсин (расщепляет белки) и др.:
АВ + Н20 АОН + ВН.
Лиазы Негидролитическое присоединение к субстрату или отщепление от него группы атомов. При этом могут разрываться связи С-С, C-N, С-О, C-S. Например, декарбоксилаза отщепляет карбоксильную группу:
Изомеразы Внутримолекулярные перестройки, превращение одного изомера в другой (изомеризация):
глюкозо-6-фосфат глюкозо-1-фосфат.
Лигазы (синтетазы) Реакции соединения двух молекул с образованием новых связей С–О, С–S, С–N, С–С, с использованием энергии АТФ. Например, фермент валин-тРНК-синтетаза, под действием которого образуется комплекс валин– тРНК:
АТФ + валин + тРНК АДФ + Н3Р04 + валин-тРНК.

Механизм действия фермента представлен на рис. 4. В молекуле каждого фермента имеется активный центр – это один или более участков, в которых происходит катализ за счет тесного контакта между молекулами фермента и специфического вещества (субстрата). Активным центром выступает или функциональная группа (например, ОН-группа), или отдельная аминокислота. Активный центр может формироваться связанными с ферментом ионами металлов, витаминами и другими соединениями небелковой природы – коферментами или кофакторами. Форма и химическое строение активного центра таковы, что с ним могут связываться только определенные субстраты в силу их идеального соответствия (комплементарности) друг другу.

Молекула фермента изменяет глобулярную форму молекулы субстрата. Молекула субстрата, присоединяясь к ферменту, тоже в определенных пределах изменяет свою конфигурацию для увеличения реакционности функциональных групп центра.

На заключительном этапе химической реакции фермент-субстратный комплекс распадается с образованием конечных продуктов и свободного фермента. Освободившийся при этом активный центр может принимать новые молекулы субстрата.

II. Обобщающая беседа об основополагающей роли белков как самых необходимых химических соединений для жизней деятельности всего живого на Земле.

III. Закрепление знаний в процессе беседы с помощью следующих вопросов:

  1. Какие органические вещества клетки можно назвать самыми важными?
  2. Каким образом создается бесконечное разнообразие белков?
  3. Что собой представляют мономеры биополимера белка?
  4. Как формируется пептидная связь?
  5. Что собой представляет первичная структура белка?
  6. Каким образом происходит переход первичной структуры молекул белка во вторичную, а затем– в третичную и четвертичную?
  7. Какие функции могут выполнять белковые молекулы?
  8. Чем обусловлено многообразие функций белковых молекул?
  9. Приведите примеры белков, выполняющих самые разные функции. При ответе можно использовать следующую схему:

Биологические функции белков.

Это интересно.

Многие молекулы очень велики и по длине, и по молекулярной массе. Так, молекулярная масса инсулина – 5700, белка-фермента рибонуклеазы – 127 ООО, яичного альбумина – 36 ООО, гемоглобина – 65 ООО. В состав различных белков входят самые разные аминокислоты. Набор всех двадцати видов аминокислот содержит: казеин молока, миозин мышц и альбумин яйца. В белке-ферменте рибонуклеазе – 19, в инсулине – 18 аминокислот. Коллекти

urok.1sept.ru

введение для айтишников / Habr

Приятно видеть, что хабравчане регулярно интересуется другими предметными областями – например, биологией (более конкретно – структурой и функцией биологических макромолекул). Однако некоторые посты (например, этот), вызывают у специалиста просто физическую боль из-за обилия совершенно диких фактологических ошибок. В этом посте мне хочется рассказать о структуре и функции белка. О том, что мы знаем и о том, чего не знаем, а так же об имеющихся в этой области вычислительных задачах, требующих решения и интересных IT-специалистам. Постараюсь рассказывать сжато и тезисно, чтобы информации было больше, а воды – меньше. Всех, интересующихся структурой белков, прошу под кат, там очень много букв.

1. Почему белки важны?

Как сказал Фридрих Энгельс, “Жизнь есть способ существования белковых тел”. В 19 веке еще не знали о роли ДНК в наследовании генетической информации, но утверждение дяди Фридриха в значительной мере справедливо до сих пор – основную работу в наших клетках совершают именно белки. Это и поддержание структуры (формы клеток), и химический катализ, и моторная функция (сокращение мышц, например), и транспорт (скажем, белок гемоглобин переносит кислород из легких в ткани и углекислый газ в обратном направлении) и сложные регуляторные функции по поддержанию постоянства внутренней среды (скажем, белковые гормоны и всякие внутриклеточные регуляторные системы) и многие другие. Словом, если в нашем организме что-то происходит, в это обязательно вовлечены белки (хотя и не только они).
2. Что такое белок?

С химической точки зрения белок – это линейный (неветвящийся) полимер, состоящий из монотонно повторяющихся одинаковых блоков «основной цепи», к которым приделаны различные «боковые группы». Так как блоки основной цепи несимметричны, вся полипептидная цепь белка имеет направление, различают N- и C-конец полипептидной цепи.

Длина цепи – от 70 до более чем 1000 мономеров (аминокислотных остатков), средняя длина для высших организмов – примерно 500-600 аминокислотных остатков, для бактерий эта величина будет меньше, скорее 300-400 остатков. Всего в природе существует 20 стандартных аминокислот, одинаковых и для бактерии и для человека, то есть из основной цепи могут торчать 20 разных боковых групп.

(Тут возможна поправка – некоторые химические группы могут быть модифицированны после синтеза белка, например, фосфорилированы. Однако это не рассматривается как другая аминокислота, а рассматривается как продукт модификации исходной. Так же у высших организмов возможно встраивание двух неканонических аминокислот, но это редкое событие. То есть, строго говоря, разных аминокислот 22, из них 20 основных и 2 редкие, плюс некоторые боковые группы могут быть изредка химически модифицированы).

Из поколения в поколение генетическая информация передается в виде ДНК, в ней есть так называемые «белок-кодирующие области». В этих местах ДНК однозначным образом (для ботанов – с точностью до альтернативного сплайсинга и редактирования РНК) закодирована информация о линейной последовательности аминокислот для синтеза данного белка, плюс в клетке есть соответствующие машины, способные синтезировать белок по информации, изначально закодированной в ДНК.

Так как белок – линейный полимер, собранный из 20 стандартных мономеров, его так называемую «первичную структуру» легко представить в виде строки, например так:

 >small ubiquitin-related modifier 3 precursor [Homo sapiens] MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQG LSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF 

Это аминокислотная последовательность маленького человеческого белка в формате FASTA, первая строчка, начинающаяся с «>», описывает его название, после чего следует последовательность аминокислот в соответствии со стандартной кодировкой (например, М –метиони, S – серин и тд, всего 20 букв стандартного однобуквенного кода), слева – N-конец белка, справа – его С-конец. Для разных белков длина строки будет очевидно разной, так как белки имеют разную длину. Последовательности всех известных белков можно найти в открытом доступе здесь: www.ncbi.nlm.nih.gov

3. Структура белка

Хорошо, с первичной структурой разобрались, но разве белок работает в развернутом линейном виде? Конечно нет. Тут надо заметить, что со структурной точки зрения есть разные классы белков: глобулярные, мембранные и фибриллярные. Мембранные белки, как следует из названия, живут только в клеточных мембранах, для стабилизации их структуры нужно особое окружение мембраны, мы не будем их рассматривать в этом обзоре. Фибриллярные белки имеют простое регулярное строение, похожи на вытянутые волокна, они не растворимы в воде и выполняют структурные функции (например, из кератина состоят волосы, к фибриллярным белкам относится белок из натурального шёлка). Недавно стали выделять класс разупорядоченных белков – белков, не обладающих постоянной трехмерной структурой, либо приобретающих ее только на короткое время при взаимодействии с другими белками. Наиболее интересный с практической точки зрения класс белков, который мы и будем рассматривать – глобулярные водорастворимые белки, к этому классу относится большинство белков.

Линейная полипептидная цепь в воде способна самопроизвольно сворачиваться в сложную трехмерную структуру (глобулу) и только в таком свернутом виде белки могут выполнять химический катализ и прочую интересную работу. Поэтому нам принципиально важно знать именно трехмерную укладку белка, так как только на этом уровне становится понятно, как белок работает.

Вопрос: сколько трехмерных структур соответствует конкретному белку?
Ответ: Одна, с точностью до небольшой подвижности маленьких «разупорядоченных» петель. Известно ровно одно исключение, когда одной последовательности соответствуют 2 достаточно разные структуры, это прионы.

Вопрос: Почему у белка только одна трехмерная структура?
Ответ: для химического катализа нам нужно расположить соответствующие химические группы строго определенным образом в пространстве. Для этого нужна жесткая структура. То есть весь белок должен быть жестким, чтобы поддерживать химические группы аминокислот активного центра в нужных местах (в реальности многие белки состоят из двух и более жестких частей, которые могут двигаться друг относительно друга, это нужно для регуляции активности белка (аллостерическая регуляция), чтобы некий сигнал мог включать и выключать химическую активность белка-фермента). Чтобы структура была жесткой и стабильной, природа позаботилась о том, чтобы структура каждого белка соответствовала энергетическому минимуму данной системы атомов и этот минимум был настолько глубоким, чтобы белок из него не «выпрыгнул». Все другие, паразитные структуры, обладают большей энергией и белок все равно сваливается в энергетический минимум, соответствующий нативной структуре.

Вопрос: на чем держится трехмерная структура белка?
Ответ: если коротко, то в основном на большом количестве нековалентных взаимодействий. В принципе, химические группы белка могут образовывать: (1) водородную связь, эти группы есть и в основной цепи и у некоторых боковых групп, (2) ионную связь – электростатическое взаимодействие между разноименно заряженными боковыми группами, (3) Ван-дер-Ваальсово взаимодействие и (4) гидрофобный эффект, на котором держится общая структура белка. Суть в том, что в белке всегда есть гидрофобные ароматические остатки, им энергетически невыгодно контактировать с полярными молекулами воды, а выгодно «слипнуться» друг с другом. Таким образом, при сворачивании белка гидрофобные группы выталкиваются из водного окружения, «слипаясь» друг с другом и формируя «гидрофобное ядро», а полярные и заряженные группы, наоборот, стремятся в водное окружение, формируя поверхность белковой глобулы. Так же (5) боковые группы двух остатков цистеина могут образовать между собой дисульфидный мостик – полноценную ковалентную связь, жестко фиксирующую белок.

Соответственно, все аминокислоты делятся на гидрофобные, полярные (гидрофильные), положительно и отрицательно заряженные. Плюс цистеины, способные образовывать ковалентную связь между собой. Особыми свойствами обладают глицин – у него отсутствует боковая группа, сильно ограничивающая конформационную подвижность других остатков, поэтому он может очень сильно «гнуться» и находится в местах, где белковую цепь надо развернуть. У пролина же, наоборот, боковая группа образует кольцо, ковалентно связанное с основной цепью, жестко фиксируя ее конформацию. Пролины встречаются там, где надо сделать белковую цепь жесткой и негнущейся. Многие заболевания связаны с мутацией пролина на глицин, из-за чего структура белка слегка «плывет».

Вопрос: откуда вообще мы знаем о трехмерных структурах белка?
Ответ: из эксперимента, это абсолютно надежные данные.
Сейчас есть 3 метода для экспериментального определения структуры белка: ядерно-магнитный резонанс (ЯМР), cryo-EM (электронная микроскопия) и рентгеноструктурный анализ кристаллов белка.

ЯМР позволяет определить структуру белка в растворе, но он работает только для очень маленьких белков (для больших невозможно сделать деконволюцию).

Этот метод был важен для общего доказательства того, что у белка только одна трехмерная структура и что структура белка в кристалле идентична структуре в растворе. Это очень дорогой метод, так как требуется получить белок с изотопными метками.

Cryo-EM заключается в простой заморозке раствора белка и микроскопии. Минус метода – низкое разрешение (видна лишь общая форма молекулы, но не видно, как она устроена внутри), плюс плотность белка близка к плотности воды/растворителя, поэтому сигнал тонет в высоком уровне шума. В этом методе активно применяются компьютерные технологии работы с картинками и статистика для вытягивания сигнала из шума.

Отбираются миллионы картинок молекул белка, проводится разделение на классы в зависимости от ориентации молекулы относительно подложки, усреднение по классам, генерация eigenimages, новый раунд усреднения и так пока не сойдется. Потом из информации из разных классов можно восстановить трехмерный вид молекулы с низким разрешением. Если же есть внутренняя симметрия частиц (например, при cryo-EM анализе вирусов), то можно еще каждую частицу поусреднять в соответствии с операторами симметрии – тогда разрешение будет еще лучше, но хуже, чем в случае рентгеноструктурного анализа.

Рентгеноструктурный анализ – основной способ определения структур белка. Главный плюс – потенциально можно получить кристаллы даже очень больших комплексов из многих десятков белков (например, именно так была определена структура рибосомы – Нобелевская премия 2009 года). Минус метода – вначале нужно получить кристалл белка, но далеко не каждый белок хочет кристаллизоваться.

Зато после того, как кристалл получен, по дифракции рентгеновского излучения можно однозначно определить положения всех (упорядоченных) атомов в молекуле белка, этот метод дает самое высокое разрешение и позволяет в лучших случаях видеть позиции отдельных атомов. Было доказано, что структура белка в кристалле однозначно соответствует структуре в растворе.

Сейчас действует конвенция – если ты определил структуру белка любым из экспериментальных физических методов, структура должна быть помещена в открытый доступ в банк данных белковых структур (Protein Data Bank – PDB, www.pdb.org ), в настоящее время там находится более 90 000 структур (впрочем, многие из них повторяющиеся, например, комплексы одного и того же белка с разными малыми молекулами, такими, как лекарственные средства). В PDB все структуры лежат в стандартном формате, называющемся, внезапно, pdb. Это текстовый формат, в котором каждому атому структуры соответствует одна строчка, в которой указан номер атома в структуре, название атома (углерод, азот и тд), название аминокислоты, в которую входит атом, название цепи белка (A, B, C и тд, если это кристалл комплекса из нескольких белков), номер аминокислоты в цепи и трехмерные координаты атома в ангстремах относительно ориджина, плюс так называемые температурный фактор и заселённость (это сугубо кристаллографические параметры).

 ATOM 1 N HIS A 17 -12.690 8.753 5.446 1.00 29.32 N ATOM 2 CA HIS A 17 -11.570 8.953 6.350 1.00 21.61 C ATOM 3 C HIS A 17 -10.274 8.970 5.544 1.00 22.01 C ATOM 4 O HIS A 17 -10.193 8.315 4.491 1.00 29.95 O ATOM 5 CB HIS A 17 -11.462 7.820 7.380 1.00 23.64 C ATOM 6 CG HIS A 17 -12.551 7.811 8.421 1.00 21.18 C ATOM 7 ND1 HIS A 17 -13.731 7.137 8.194 1.00 28.94 N ATOM 8 CD2 HIS A 17 -12.634 8.384 9.644 1.00 21.69 C ATOM 9 CE1 HIS A 17 -14.492 7.301 9.267 1.00 27.01 C ATOM 10 NE2 HIS A 17 -13.869 8.058 10.168 1.00 22.66 N ATOM 11 N ILE A 18 -9.269 9.660 6.089 1.00 19.45 N ATOM 12 CA ILE A 18 -7.910 9.377 5.605 1.00 18.67 C ATOM 13 C ILE A 18 -7.122 8.759 6.749 1.00 16.24 C ATOM 14 O ILE A 18 -7.425 8.919 7.929 1.00 18.80 O ATOM 15 CB ILE A 18 -7.228 10.640 5.088 1.00 20.22 C ATOM 16 CG1 ILE A 18 -7.062 11.686 6.183 1.00 18.52 C ATOM 17 CG2 ILE A 18 -7.981 11.176 3.889 1.00 24.61 C ATOM 18 CD1 ILE A 18 -6.161 12.824 5.749 1.00 28.21 C ATOM 19 N ASN A 19 -6.121 8.023 6.349 1.00 15.46 N ATOM 20 CA ASN A 19 -5.239 7.306 7.243 1.00 14.34 C ATOM 21 C ASN A 19 -4.012 8.178 7.507 1.00 14.83 C ATOM 22 O ASN A 19 -3.431 8.715 6.575 1.00 18.03 O ATOM 23 CB ASN A 19 -4.825 6.003 6.573 1.00 17.71 C ATOM 24 CG ASN A 19 -6.062 5.099 6.413 1.00 21.26 C ATOM 25 OD1 ASN A 19 -6.606 4.651 7.400 1.00 26.18 O ATOM 26 ND2 ASN A 19 -6.320 4.899 5.151 1.00 31.73 N 

Далее есть специальные программы, которые по данным из этого текстового файла могут графически отображать красивую трехмерную структуру молекулы белка, которую можно покрутить на экране монитора и, как говорил Гай Додсон, «дотронуться мышкой до молекулы» (например, PyMol, CCP4mg, старый RasMol). То есть смотреть на структуры белка просто – ставишь программу, загружаешь нужную структуру из PDB и наслаждаешься красотой природы.

4. Анализируем структуру

Итак, мы поняли основную идею: белок — линейный полимер, сворачивающийся в водном растворе под действием множества слабых взаимодействий в стабильную и единственную для данного белка трехмерную структуру, и способный в таком виде выполнять свою функцию. Различают несколько уровней организации белковых структур. Выше мы уже познакомились с первичной структурой – линейной последовательностью аминокислот, которую можно выписать в строчку.

Вторичная структура белка определяется взаимодействием атомов основной цепи белка. Как уже было сказано выше, в состав основной цепи белка входят доноры и акцепторы водородной связи, таким образом, основная цепь может приобретать некоторую структуру. Точнее, несколько разных структур (детали все-таки зависят от различающихся боковых групп), так как возможно образование разных альтернативных водородных связей между группами основной цепи. Структуры бывают такие: альфа-спираль, бета-листы (состоящие из нескольких бета-тяжей), которые бывают параллельными и анти-параллельными, бета-поворот. Плюс часть цепи может и не иметь выраженной структуры, например в районе поворота петли белка. Эти типы структур имеют свои устоявшиеся схематичные обозначения – альфа-спираль в виде спирали или цилиндра, бета-тяжи в виде широких стрелок. Вторичную структуру удается достаточно достоверно предсказывать по первичной (стандартом является JPred), альфа-спирали предсказываются наиболее точно, с бета-тяжами бывают накладки.

Третичная структура белка определяется взаимодействием боковых групп аминокислотных остатков, это и есть трехмерная структура белка. Можно представить себе, что вторичная структура сформирована и теперь эти спирали и бета-тяжи хотят уложиться все вместе в компактную трехмерную структуру, чтобы все гидрофобные боковые группы спокойно «слиплись» вместе в глубине белковой глобулы, сформировав гидрофобное ядро, а полярные и заряженные остатки торчали наружу в воду, формируя поверхность белка и стабилизируя контакты между элементами вторичной структуры. Третичную структуру изображают схематически несколькими способами. Если просто отрисовать все атомы, то получится каша (хотя когда мы анализируем активный центр белка, то мы хотим смотреть как раз на все атомы активных остатков).

Если мы хотим посмотреть, как устроен весь белок в общем, можно отобразить только некоторые атомы основной цепи, чтобы увидеть ее ход. Как вариант, можно нарисовать красивую схему, где поверх реального расположения атомов схематично нарисованы элементы вторичной структуры – так с первого взгляда видна укладка белка. После изучения всей структуры в общем, схематичном виде, можно отобразить химические группы активного центра и уже сосредоточиться на них. Задача предсказания третичной структуры белка – нетривиальная и в общем случае не решается, хотя может быть решена в частных случаях. Подробнее – ниже.

Четвертичная структура белка – да, есть и такая, правда не у всех белков. Многие белки работают сами по себе (мономеры, в данном случае под мономером имеется в виду одиночная свернутая полипептидная цепь, то есть белок целиком), тогда их четвертичная структура равна третичной. Однако достаточно много белков работает только в комплексе, состоящем из нескольких полипептидных цепей (субъединиц или мономеров — димеры, тримеры, тетрамеры, мультимеры), тогда вот такая сборка из нескольких отдельных цепей и называется четвертичной структурой. Самый банальный пример – состоящий из 4 субъединиц гемоглобин, самый красивый на мой взгляд пример – состоящий из 11 одинаковых субъединиц бактериальный белок TRAP.

5. Вычислительные задачи

Белок – сложная система из тысяч атомов, поэтому без использования компьютеров в структуре белка не разобраться. Задач, как решенных на приемлемом уровне, так и совсем не решенных, множество. Перечислю наиболее актуальные:

На уровне первичной структуры – поиск белков с похожей аминокислотной последовательностью, построение по ним эволюционных деревьев и тд – классические задачи биоинформатики. Главным хабом является NCBI — The National Center for Biotechnology Information, www.ncbi.nlm.nih.gov. Для поиска белков со сходной последовательностью стандартно используется BLAST: blast.ncbi.nlm.nih.gov/Blast.cgi

Предсказание растворимости белка. Речь идет о том, что если мы прочитаем геном какого-нибудь животного, определим по нему последовательности белков, переклонируем эти гены в кишечную палочку или baculovirus expression system, то окажется, что при экспрессии в этих системах примерно треть белков не будет сворачиваться в правильную структуру, и, как следствие, будет нерастворима. Тут выясняется, что большие белки на самом деле состоят из отдельных «доменов», каждый из которых представляет автономную, функциональную часть белка (несущую одну из его функций) и часто «вырезав» из гена отдельный домен, можно получить растворимый белок, определить его структуру и провести с ним опыты. Люди пытаются использовать машинное обучение (нейронные сети, SVM и прочие классификаторы), чтобы предсказывать растворимость белка, однако работает оно достаточно плохо (Гугл много чего покажет по запросу “protein solubility prediction” – есть много серверов, но по моему опыту все они работают отвратительно на моих белках). В идеале я хотел бы видеть сервис, который надежно сказал бы, где в белке находятся те самые растворимые домены, чтобы их можно было вырезать и работать с ними – такого сервиса нет.

На уровне вторичной структуры – предсказание той самой вторичной структуры по первичной (JPred)

На уровне третичной структуры – поиск белков со сходными трехмерными структурами (DALI, en.wikipedia.org/wiki/Structural_alignment ),
Поиск структур по заданной суб-структуре. Например, у меня есть расположение трех аминокислот активного центра в пространстве. Хочу найти структуры, которые содержать такие же три аминокислоты в таком же относительном расположении, либо найти структуры белков, мутирование которых даст возможность расположить нужные аминокислоты нужным образом. (гуглить «protein substructure search»)
Предсказание потенциальной подвижности трехмерной структуры, возможных конформационных изменений – normal mode analysis, ElNemo.

На уровне четвертичной структуры – предположим, известны структуры двух белков. Известно, что они образуют комплекс. Предсказать структуру комплекса (определить, как эти два белка будут взаимодействовать посредством shape matching, например). Гуглить «protein-protein docking»

6. Предсказание структуры белка

Выделил эту вычислительную задачу в отдельный раздел, ибо велика она, фундаментальна и не решается в общем случае.

Экспериментально мы знаем, что если взять белок, полностью развернуть его и бросить в воду, то он свернется обратно в исходное состояние за время от миллисекунд до секунд (это утверждение справедливо по крайней мере для небольших глобулярных белков без всяких патологий). Это значит, что вся информация, необходимая для определения трехмерной структуры белка, в неявном виде содержится в его первичной последовательности, поэтому так хочется научиться предсказывать трехмерную структуру белка по последовательности аминокислот in silico! Однако эта задача в общем случае не решена до сих пор. В чем же дело? Дело в том, что в первичной последовательности отсутствует в явном виде информация, необходимая для построения структуры. Во-первых, нет информации о конформации основной цепи – а она обладает значительной подвижностью, хотя и несколько ограниченной по стерическим причинам. Плюс каждая боковая цепь каждой аминокислоты может находиться в разных конформациях, для длинных боковых групп типа аргинина, это может быть больше десятка конформаций.

Что же делать? Есть достаточно известный хабравчанам самый общий подход, называемый «молекулярная динамика» и подходящий для любых молекул и систем. Берем развернутый белок, приписываем всем атомам случайные значения скоростей, считаем взаимодействия между атомами, повторяем до тех пор, пока система не придет в стабильное состояние, соответствующее свернутому белку. Почему это не работает? Потому что современные вычислительные мощности позволяют за месяцы работы кластера считать десятки наносекунд для системы из тысяч атомов, какой является белок, помещенный в воду. Время же сворачивания белка – миллисекунды и больше, то есть вычислительных мощностей не хватает, разрыв – в несколько порядков. Впрочем, пару лет назад американцы совершили некоторый прорыв. Они использовали специальное железо, оптимизированное для векторных вычислений и после оптимизации на аппаратном уровне у них за месяцы работы машины получилось посчитать молдинамику до миллисекунд для очень маленького белка и белок свернулся, структура соответствовала экспериментально определенной ( http://en.wikipedia.org/wiki/Anton_(computer) )! Однако праздновать победу еще рано. Они взяли очень маленький (его размер раз в 5-10 меньше среднего белка) и один из самых быстросворачивающихся белков, классический модельный белок, на котором изучалось сворачивание. Для больших белков время расчетов увеличивается нелинейно и потребуются уже годы, то есть еще есть над чем работать.

Другой подход реализован в Rosetta. Они разбивают последовательность белка на очень короткие (3-9 остатков) фрагменты и смотрят, какие конформации для этих фрагментов присутствуют в PDB, после чего запускают Монте-Карло по всем вариантам и смотрят, что получится. Иногда получается что-то годное, но в моих случаях через несколько дней работы кластера получаешь такой бублик, что возникает немой вопрос: «Кто писал их оценочную функцию, ставящую какую-то хорошую оценку вот этой загогулине?».

Есть инструменты и для моделирования вручную – можно предсказать вторичную структуру и попробовать вручную крутить ее, находя лучшую укладку. Некие гениальные люди даже выпустили игрушку FoldIt, представляющую белок схематично и позволяющую укладывать его, как-бы собирая головоломку (для интересующихся структурой – рекомендую!). Есть абсолютно официальное соревнование для предсказателей белковых структур, называемое CASP. Суть в том, что когда экспериментаторы определяют новую структуру белка, не имеющую аналогов в PDB, они могут не выкладывать ее сразу в PDB, а выставить последовательность этого белка на конкурс предсказаний CASP. Через некоторое время, когда все закончат свои предсказательные модели, экспериментаторы выкладывают свою экспериментально определенную структуру белка и смотрят, насколько хорошо сработали предсказатели. Самое интересное, что игроки FoldIt, не будучи учеными, как-то выиграли CASP у профессионалов моделирования белковых структур и предсказали структуру белка точнее. Однако даже эти успехи не позволяют утверждать, что проблема предсказания структуры белка решается – очень часто модель очень далека от реальной структуры.

Все это относилось к моделированию белков ab initio, когда нет никакой априорной информации о структуре. Однако очень часто бывают ситуации, когда для некоторого белка в PDB присутствует его отдаленный родственник с уже известной структурой. Под родственником подразумевается белок с похожей первичной последовательностью. Считается, что для белков со сходством по первичной последовательности больше 30% одинаковая укладка основной цепи (хотя одинаковая укладка наблюдалась и для белков, не проявляющих никакого статистически достоверного сходства по первичной последовательности). В случае наличия гомолога (похожего белка) с известной структурой, можно сделать «гомологичное моделирование», то есть попросту «натянуть» последовательность твоего белка на известную структуру гомолога, а потом погонять минимизацию энергии, чтобы как-то все это дело утрясти. Такое моделирование показывает хорошие результаты при наличие очень близких гомологов, чем дальше гомолог – тем больше ошибка. Инструменты для гомологичного моделирования – Modeller, SwissModel.

Можно решать и другие задачи, например, пытаться моделировать, что произойдет, если внести в белок ту или иную мутацию. Например, если заменить гидрофильную аминокислоту на поверхности белка на другую гидрофильную, то скорее всего структура белка не изменится вообще. Если заменить аминокислоту из гидрофобного ядра на другую гидрофобную, но другого размера, то скорее всего укладка белка останется той же, но слегка «съедет» на доли ангстрема. Если же заменить аминокислоту из гидрофобного ядра на заряженную, то скорее всего белок просто «взорвется» и не сможет свернуться.

Может показаться, что все не так уж и плохо и мы достаточно хорошо пониманием сворачивание белка. Да, мы понимаем кое-что, например до некоторой степени мы понимаем общие физические принципы, лежащие в основе сворачивания полипептидной цепи – они рассматриваются в замечательном учебнике Птицына и Финкельштейна «Физика белка». Однако это общее понимание не позволяет нам ответить на вопросы «Свернется ли данный белок или не свернется?», «Какая структура будет у этого белка?», «Как сделать белок с желаемой структурой?».

Вот одна из иллюстраций: мы хотим локализовать один из доменов большого белка, это стандартная задача. У нас есть фрагмент, который сворачивается и растворим, то есть это живой и здоровый белок. Мы же хотим найти его минимальную часть и начинаем методами генетической инженерии с обоих концов удалять по 2-3 аминокислоты, экспрессировать такой обрезанный белок в бактерии и смотреть его сворачиваемость экспериментально. Мы делаем десятки конструкций с такими маленькими делециями и видим такую картину – полностью растворимый и живой белок отличается от полностью мертвого и несворачивающегося на 3 аминокислоты. Повторюсь, это объективный экспериментальный результат. Проблема в том, что сейчас не существует вычислительного метода, который предсказал бы сворачиваемость белка хотя бы на уровне «да/нет» и сказал мне, где проходит граница между сворачивающимся и несворачивающимся белком, потому мы вынуждены клонировать и экспериментально проверять десятки вариантов. Это лишь одна из иллюстраций того, что наше понимание структуры белка весьма далеко от совершенства. Как говорил Ричард Фейнман, «Чего не могу воссоздать, того не понимаю».

Так что, господа программисты, физики и математики, нам еще есть над чем работать.

На этой оптимистичной ноте разрешите откланяться, благодарю всех, кто осилил сей опус.

Для глубоко знакомства с предметной областью рекомендую следующий минимум:
1) «Физика белка» Птицын и Финкельштейн. Большую часть материала Алексей Витальевич Финкельштейн выложил в онлайн, чем и рекомендую с благодарностью воспользоваться: phys.protres.ru/lectures/protein_physics/index.html (а я утащил оттуда несколько картинок)
2) Патрушев, «Искусственные генетические системы», особенно часть II «Белковая инженерия». Есть на торрентах в формате Djvu
3) Для информации, опубликованной в биологических научных журналах, есть официальный поисковик PubMed ( www.pubmed.org ) — у него стоит попросить почитать про «protein engineering» и тому подобное.

habr.com

Белки, их строение и функции — Студопедия

Белки – это биологические гетерополимеры, мономерами которых являются аминокислоты. Белки синтезируются в живых организмах и выполняют в них определенные функции.

В состав белков входят атомы углерода, кислорода, водорода, азота и иногда серы. Мономерами белков являются аминокислоты – вещества, имеющие в своем составе неизменяемые части аминогруппу Nh3 и карбоксильную группу СООН и изменяемую часть – радикал. Именно радикалами аминокислоты отличаются друг от друга. Аминокислоты обладают свойствами кислоты и основания (они амфотерны), поэтому могут соединяться друг с другом. Их количество в одной молекуле может достигать нескольких сотен. Чередование разных аминокислот в разной последовательности позволяет получать огромное количество различных по структуре и функциям белков.

В белках встречается 20 видов различных аминокислот, некоторые из которых животные синтезировать не могут. Они получают их от растений, которые могут синтезировать все аминокислоты. Именно до аминокислот расщепляются белки в пищеварительных трактах животных. Из этих аминокислот, поступающих в клетки организма, строятся его новые белки.

Структура белковой молекулы . Под структурой белковой молекулы понимают ее аминокислотный состав, последовательность мономеров и степень скрученности молекулы, которая должна умещаться в различных отделах и органоидах клетки, причем не одна, а вместе с огромным количеством других молекул.


Последовательность аминокислот в молекуле белка образует его первичную структуру. Она зависит от последовательности нуклеотидов в участке молекулы ДНК (гене), кодирующем данный белок. Соседние аминокислоты связаны пептидными связями, возникающими между углеродом карбоксильной группы одной аминокислоты и азотом аминогруппы другой аминокислоты.

Длинная молекула белка сворачивается и приобретает сначала вид спирали. Так возникает вторичная структура белковой молекулы. Между СО и NH – группами аминокислотных остатков, соседних витков спирали, возникают водородные связи, удерживающие цепь.

Молекула белка сложной конфигурации в виде глобулы (шарика), приобретает третичную структуру. Прочность этой структуры обеспечивается гидрофобными, водородными, ионными и дисульфидными S-S связями.

Некоторые белки имеют четвертичную структуру, образованную несколькими полипептидными цепями (третичными структурами). Четвертичная структура так же удерживается слабыми нековалентными связями – ионными, водородными, гидрофобными. Однако прочность этих связей невелика и структура может быть легко нарушена. При нагревании или обработке некоторыми химическими веществами белок подвергается денатурации и теряет свою биологическую активность. Нарушение четвертичной, третичной и вторичной структур обратимо. Разрушение первичной структуры необратимо.


В любой клетке есть сотни белковых молекул, выполняющих различные функции. Кроме того, белки имеют видовую специфичность. Это означает, что каждый вид организмов обладает белками, не встречающимися у других видов. Это создает серьезные трудности при пересадке органов и тканей от одного человека к другому, при прививках одного вида растений на другой и т.д.

Функции белков. Каталитическая (ферментативная ) – белки ускоряют все биохимические процессы, идущие в клетке: расщепление питательных веществ в пищеварительном тракте, участвуют в реакциях матричного синтеза. Каждый фермент ускоряет одну и только одну реакцию (как в прямом, так и в обратном направлении). Скорость ферментативных реакций зависит от температуры среды, уровня ее рН, а также от концентраций реагирующих веществ и концентрации фермента.

Транспортная – белки обеспечивают активный транспорт ионов через клеточные мембраны, транспорт кислорода и углекислого газа, транспорт жирных кислот.

Защитная – антитела обеспечивают иммунную защиту организма; фибриноген и фибрин защищают организм от кровопотерь.

Структурная – одна из основных функций белков. Белки входят в состав клеточных мембран; белок кератин образует волосы и ногти; белки коллаген и эластин – хрящи и сухожилия.

Сократительная – обеспечивается сократительными белками – актином и миозином.

Сигнальная – белковые молекулы могут принимать сигналы и служить их переносчиками в организме (гормонами). Следует помнить, что не все гормоны являются белками.

Энергетическая – при длительном голодании белки могут использоваться в качестве дополнительного источника энергии после того, как израсходованы углеводы и жиры.

studopedia.ru

Составьте схему «Функции белков в клетке».

Функции белков в клетке многообразны. Одна из важнейших — строительная функция: белки входят в состав всех клеточных мембран и органоидов клетки, а также внеклеточных структур. Для обеспечения жизнедеятельности клетки исключительно важное значение имеет каталитическая, или. ферментативная, роль белков. Биологические катализаторы, или ферменты, — это вещества белковой природы, ускоряющие химические реакции в десятки и сотни тысяч раз.
Ферментам свойственны некоторые черты, отличающие их от катализаторов неорганической природы. Во-первых, один фермент катализирует только одну реакцию или один тип реакций, т. е. биологический катализ специфичен. Во-вторых, активность ферментов ограничена довольно узкими температурными рамками (35— 45 °С), за пределами которых их активность снижается или исчезает. В-третьих, ферменты активны при физиологических значениях рН, т. е. в слабощелочной среде. Еще одно важное отличие ферментов от неорганических катализаторов: биологический катализ протекает при нормальном атмосферном давлении.
Все это определяет ту важную роль, которую ферменты играют в живом организме. Практически все химические реакции в клетке протекают с участием ферментов. Двигательная функция живых организмов обеспечивается специальными сократительными белками. Эти белки участвуют во всех видах движения, к которым способны клетки и организмы: мерцание ресничек и биение жгутиков у простейших, сокращение мышц у многоклеточных животных и пр. Транспортная функция белков заключается в присоединении химических элементов (например, кислорода) или биологически активных веществ (гормонов) и переносе их к различным тканям и органам тела.
При поступлении в организм чужеродных белков или микроорганизмов белые кровяные тельца лейкоциты— образуют особые белки — антитела. Они связывают и обезвреживают не свойственные организму вещества — это защитная функция белков. Белки служат также источником энергии в клетке, т. е. выполняют энергетическую функцию. При полном расщеплении 1 г белка выделяется 17,6 кДж энергии.

www.soloby.ru

Сигнальная функция белка — Википедия

Материал из Википедии — свободной энциклопедии

Сигнальная функция белков — способность белков служить сигнальными веществами, передавая сигналы между тканями, клетками или организмами.

Регуляторную функцию выполняют белки-гормоны. Связывание гормона с рецептором является сигналом, запускающим в клетке физиологические процессы. Гормоны регулируют концентрации веществ в крови и клетках, рост, размножение и другие процессы. Например, инсулин снижает содержание сахара в крови, гормон роста регулирует рост скелета, лептин регулирует аппетит.

Клетки могут взаимодействовать друг с другом на расстоянии с помощью специальных белков, передаваемых через межклеточное вещество. К таким белкам относятся цитокины, факторы роста и др.

Цитокины — небольшие пептидные информационные молекулы. Они регулируют взаимодействия между клетками, определяют жизнедеятельность клеток, их выживаемость, стимулируют или подавляют рост, дифференциацию, функциональную активность и апоптоз (явление программируемой клеточной смерти), обеспечивают согласованность и упорядоченность действий иммунной, эндокринной и нервной систем. Примером цитокинов может служить фактор некроза опухолей, который передаёт сигналы воспаления между клетками организма[1].

Белковую природу имеют также некоторые феромоны. Так, половой феромон (sex-inducing pheromone) вольвокса — гликопротеид[2]. Пептидные феромоны встречаются у самых разных организмов — от бактерий [1] (недоступная ссылка) до млекопитающих[3]

  1. ↑ Повещенко АФ., Абрамов ВВ., Козлов ВВ. Цитокины — факторы нейроэндокринной регуляции. Успехи Физиологических Наук. 2007 — 38(3):40-6
  2. ↑ Armin Hallmann, Klaus Godl, Stephan Wenzl and Manfred Sumper. The highly efficient sex-inducing pheromone system of Volvox. Trends in Microbiology Volume 6, Issue 5, 1 May 1998, Pages 185—189
  3. ↑ Touhara K. Molecular biology of peptide pheromone production and reception in mice. Adv Genet. 2007;59:147-71.

ru.wikipedia.org

Какова роль белков в клетке 🚩 белки их роль в организме 🚩 Биотехнологии

Белок – уникальный природный элемент, который является объектом пристального внимания со стороны ученых-микробиологов. Это естественный природный строительный элемент, который самостоятельно синтезируется или вычленяется организмом из потребляемых веществ.

Условно основой белка можно назвать аминокислоты, которых науке известно множество. В состав белков входят лишь 20 их видов, но в огромном количестве комбинаций. В зависимости от этих комбинаций и синтезируется белок, а точнее его особенный вид.

Белки по типу и назначению могут быть:
- строительными, позволяющими воспроизводиться клеткам,
- транспортными, переносящими кислород,
- ферментативными, служащими для обеспечения биохимической реактивности клетки,
- защитными или иммунными,
- регуляторными,
- сигнальными,
- энергетическими и пр. Есть мнение, что в организме одновременно продуцируются десятки тысяч белков, далеко не все они изучены и описаны.

Согласно школьной программе, важнейшая роль белка в организме живого существа заключается в их строительной функции. Безусловно, являясь элементом клеточной структуры, белки очень важны для построения и роста новых клеток, но значительно важнее их роль в качестве соединений, отвечающих за точное деление клеток.

Известно, что клетки не просто делятся, а буквально клонируются, передавая информацию о количестве и видах рибосом, лизосом. О митохондрии, вакуоли, информацию о ядре и его свойстве. За точность передачи информации и завершенность деления отвечают тоже белки. Есть мнение, что именно недостаток белков, которые контролируют деление и развитие клеток, является причиной возникновения рака, ведь он, по сути, результат неконролируемого деления клеточных структур.

Белок является важной составляющей мембраны или оболочки клетки. Растворы белков с низким уровнем молекул входят в состав жидкого клеточного центра. Даже в построении ДНК и РНК белки являются незаменимыми элементами.

Кроме этого белки выполняют сигнальную функцию, которая проявляется в иммунном ответе и цикле на уровне клеток. В зависимости от вида белки в клетке составляют от 50 до 80 процентов ее сухого вещества.

Источниками этих веществ могут служить различные мясные продукты и некоторые виды круп, молоко и яйца. Для правильного строения и участия во всех обменных процессах клеток организма необходимо употреблять в пищу достаточное количество белка органического происхождения, считается, что для обеспечения полноценного белкового рациона достаточно раз в неделю съедать стакан бобовых, в виде каш, супов, тушеных или пропаренных продуктов.

www.kakprosto.ru


Смотрите также

Календарь мероприятий

Уважаемые родители и ребята, ждем вас на занятия со 2го сентября по расписанию. Расписание занятий Понедельник Среда Пятница Дети с 8-13 лет 16.50 - 18.15 16.50 - 18.15 16.50 -...
Итоги турнира: 1е место - Кравченков Сергей (Алтай), 2е место - Спешков Станислав(СПБ), 3е место - Набугорнов Николай (Алтай). Победители были награждены...

Новости

Поздравляем наших участников соревнования по кикбоксингу "Открытый кубок ГБОУ ДОД ДЮСШ Выборжанин"! Юрий Кривец и Давид Горнасталев - 1 место,...